DPCstruct | MC16418
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 105 ± 6 aa |
| Standard deviation of domain lengths | 6.31 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 69.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 57.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13866 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K1RZ33 | 108-205 | VNGFSTEDDSRPGHDQICCLIDNSERCNNSAGNASYSKRIQKTVQQRKLKLARDDRVSHIYICDYHKNVIQSVRSKRKRKDSEDENG… |
| A0A2P4T1U6 | 1-110 | MNGFSTEEDSRDGPPAAPFYGQSCCLIDDGDRCVRPAGNASFSKRIQKSISQKKLKLDIDKSVRHLYICDFHKNFIQSVRNKRKRKT… |
| V8NM52 | 222-325 | None |
| A0A7R8CQD6 | 117-222 | None |
| A0A2K5X6V3 | 245-348 | None |
| T1KPK6 | 23-128 | None |
| A0A1S3FS73 | 74-196 | None |
| A0A835P268 | 40-143 | None |
| A0A210QR14 | 3-100 | None |
| A0A444U4U1 | 1-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.