DPCstruct | MC16417
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 120 ± 13 aa |
| Standard deviation of domain lengths | 13.25 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 73.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 62.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0572 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N5NLK1 | 220-329 | SQVLFALNQTLRQHEGVREGSVQGPFTTEDLITHYNCGDLSSIIFNHDTSQLPHFLNSSLLDHERSTAQQIDSYLRQELIYKRNERM… |
| A0A4Y2CUW5 | 6-118 | TSIDSRVLFALNHTLLQHELRESEMHSSYTTEDLIRHYNCGDLNSEVFGQDTAPVPNLSNNSLSEEDATAARNIDLYFRQELIYNRN… |
| A0A132A4H6 | 86-200 | None |
| A0A643BMJ0 | 16-126 | None |
| A0A5C6MRD8 | 44-168 | None |
| A0A5J5N3M8 | 49-174 | None |
| A0A834A8E5 | 134-243 | None |
| A0A341AZU1 | 10-126 | None |
| A0A812ELF0 | 135-288 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.