DPCstruct | MC16416
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 333 ± 24 aa |
| Standard deviation of domain lengths | 23.54 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 73.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 36.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19179 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P4N165 | 1-355 | MDSLSEEFFTSRAPTVEEQTKEEIKNKVEKSTDQLGKQEKDTPDLVPVNLLLEVKKLLTAINTLPKGVVPHIKKFLQENFSFQIMQR… |
| A0A7R9CHK0 | 61-401 | QISIPMSCNHGGLPEPKQKGKKKKKKKRGPIESEHITNDTFLNIAQEIRKEKLTLFPDTTPTIDHLWSAKKKDIQTLMREGSEVMAA… |
| A0A6J0XQG1 | 1-354 | None |
| A0A7J8AEI1 | 1-353 | None |
| O88196 | 423-753 | None |
| A0A7J8A2P7 | 21-354 | None |
| A0A7J7ZUU8 | 1-353 | None |
| E7EYR3 | 400-724 | None |
| A0A7J8A5Z6 | 1-303 | None |
| A0A2P4TFH5 | 1-322 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.