DPCstruct | MC16415
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 493 ± 94 aa |
| Standard deviation of domain lengths | 93.53 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 75.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 24.36 |
| Pfam Score | 78.33 |
| Assigned Pfam label(s) | CL0368- CL0126- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A814LEJ5 | 3-524 | ASFIFFVLSLPFVVFGCGITTHIEVSHRAQELWLHQPIYRQYVLRHQDALQAGSPYPDIMYNSLCFGGILHQVAEDTHWYPFMKIAI… |
| A0A3P4MEJ7 | 27-569 | CGISTHIEIGHRALEFLHLQDGRVNYKELLLEHQDAYQAGAVFPDAFYPSICERGKFHDVSESTHWTPFLNASVHYIRENYPLPWEK… |
| A0A1X2G5A0 | 3-550 | None |
| A0A2G5B7H7 | 1-614 | None |
| I1C203 | 2-419 | None |
| A0A2P6NFD4 | 56-641 | None |
| L7N2J7 | 8-427 | None |
| A0A060T7C0 | 7-589 | None |
| A0A819LLI7 | 2-481 | None |
| A0A0G4EFN8 | 13-472 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.