DPCstruct | MC16413
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 145 ± 12 aa |
| Standard deviation of domain lengths | 12.00 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 29.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M2Z9E3 | 172-324 | CRIYERRPLVCRIYPMEINPHIPLRPETKGCPPESWEQGPDLIIGDRLVDTQLMDLIEQSRQADRDEIETKQLICQKLGIRTTALKG… |
| A0A258WD87 | 13-154 | CRIYPLEARPFEAMTPEKRLCPPEAWGRDLPVLERDGEPAELQTADILSQHRQAMIDDVPFKARLAATLGFAEAALAGEGLATCEPS… |
| A0A5R9QWG3 | 223-376 | None |
| A0A158RXM2 | 2-136 | None |
| A0A7I8C1T3 | 34-190 | None |
| A0A437MHE0 | 126-268 | None |
| A0A5E7BK69 | 47-178 | None |
| A0A0P0RI48 | 12-160 | None |
| A0A7Z0JNN6 | 1-118 | None |
| A0A7W9QQL8 | 72-229 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.