DPCstruct | MC16412
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 63 ± 6 aa |
| Standard deviation of domain lengths | 6.17 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 50.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q0YL67 | 18-81 | ITYTNQEKPNASMPGSDRDEYGCIGSAGYTWCESKNECVRSWELAKEEGFENTQAAYDAFCATK |
| A0A095SCT7 | 13-69 | LAGCQPMPGSDRDKYGCLGSAGYQWCPANDSCERPWELAQEQGFERSQAAFDEYCSG |
| A0A261U045 | 7-83 | None |
| A0A2S0PFH4 | 3-62 | None |
| A0A0J1JX17 | 76-137 | None |
| I7ZAL1 | 1-54 | None |
| A0A1X9NI01 | 136-192 | None |
| A0A3N7CB26 | 31-98 | None |
| A0A0J1GND2 | 11-73 | None |
| A0A6L3N1A6 | 18-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.