DPCstruct | MC16411
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 340 ± 50 aa |
| Standard deviation of domain lengths | 49.80 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 71.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 23.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11885 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A423VBW8 | 447-671 | WAFYHGVRTLVDYSKWVPEQLQESGDVKVADKIPIEPTVANPYSHLDDVQTCYLDEQDTVPLPDVLSYPGIPAYLPAPYFGGYEELG… |
| A0A0P6Q387 | 4-377 | KDSSHREKYPYLSRESSFERDEEYYSFSDSSYGTSDSARPILRPPIPRKRPVLRPYRFPHTVMRCVCLGVFCALLLFVFALFRVTLI… |
| A0A6A6PJN0 | 5-379 | None |
| A0A3F3RWL1 | 28-397 | None |
| C9SIE6 | 1-389 | None |
| C9S5Y7 | 1-374 | None |
| A0A2H4SKU5 | 361-706 | None |
| A0A094HSS2 | 183-570 | None |
| A0A179HHV3 | 298-664 | None |
| A0A0G2HRC5 | 10-283 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.