DPCstruct | MC16407
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 151 ± 12 aa |
| Standard deviation of domain lengths | 11.84 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 80.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 31.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19853 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A537T921 | 82-228 | DDGSKPTPLETQVDQLLTEARIIIPGVQALLGFQLTVTFTQAFAQLENGAKIVHAAALCCIALAVVLLMAPASIHRIAFAGQDDPAF… |
| A0A5B0EA94 | 5-161 | SHTDTSSQDGNEELHRKWNELLQEMRVMQTGAQILAAFLVVLPFQSRFDTLEAPDEIFYLVLLVASALLIIMLVTPVAVHRHFFGQQ… |
| A0A1I5FYU4 | 196-341 | None |
| A0A173LWV0 | 9-162 | None |
| A0A7W1SBM5 | 24-190 | None |
| A0A7X0G7P7 | 2-146 | None |
| A0A7W7WX59 | 124-278 | None |
| A0A7W7PSL7 | 8-169 | None |
| A0A1H1TML9 | 33-209 | None |
| A0A1M3LEX6 | 16-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.