DPCstruct | MC16402
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 126 ± 12 aa |
| Standard deviation of domain lengths | 12.15 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 39.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X2EEU1 | 78-201 | AWDAANDPVIDLIHAQADLALQADEGVNFENKIVLSIATRLQAEKFMVGELNDPTFTDAIAGNQTAVLFNTFKNRSCGTSQSTATLD… |
| A0A2H6EDF8 | 55-180 | TLELDNSTDNMLVLIFKLADEILQSTDEIIELENKIVLSIAIRLKAESFIIQEINDQNFVDQITKNQTVKLIKKYGELFSSETKNIE… |
| A0A645FHC9 | 1-105 | None |
| A0A134AX79 | 141-285 | None |
| A0A1E3Z2B2 | 2-118 | None |
| F9PRQ9 | 340-477 | None |
| A0A377IQ90 | 122-245 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.