DPCstruct | MC164
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 278 ± 37 aa |
| Standard deviation of domain lengths | 36.94 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.40 |
| Mean intra-cluster sequence similarity (%) | 12.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V9A214 | 146-422 | SDVNPFLGVLEDVPGRDAQHPEFRAVRVLFQKNGDEWQPFRSACRDAACLKATAAQYPREVVWTIAFDGKNLGQVTSRGPSEYRYPA… |
| C1A6F4 | 25-283 | PTVLFRVDRSGNLPRLIPIATVGAKGLRSLGMTSRGWRAFDIDYLHSNATFTPYRYGEPLSAVRSTRGMWEGEPLDTLPCPSPLPAA… |
| A0A1F9S3D3 | 46-379 | None |
| A0A2V7T0W2 | 46-317 | None |
| A0A7X5WCV9 | 1-249 | None |
| I4AAK1 | 2-393 | None |
| A0A848Y0Q4 | 142-430 | None |
| A0A7Y1SXZ2 | 4-221 | None |
| D0LSI3 | 33-358 | None |
| A0A2V9ZN40 | 226-462 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.