DPCstruct | MC16399
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 95 ± 3 aa |
| Standard deviation of domain lengths | 3.41 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 85.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 34.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G4CKI1 | 212-307 | RVELRKWLQRNGIPEGPNEIVRINRRLYDPSGSGRYRVPDVHIPSENLILDGSLGFKTNSSPQIRDFYKFGNGANTTIIVPSGFGDR… |
| W1KU39 | 11-101 | RRYHQYGIDAAGKGPVRVNRRENDSSGSELSFRLPDIRVGNIAYDVTLTQKILRTPQVRGFFDADFRPTHVVIIRLRQIGAESSYII… |
| A0A2D9NSB7 | 126-221 | None |
| A0A525III2 | 373-467 | None |
| A0A522Q8B1 | 1-91 | None |
| A0A2N0H4M5 | 774-876 | None |
| A0A4Q3KRT7 | 218-310 | None |
| A0A0E9MQU7 | 255-345 | None |
| A0A5C7JKN8 | 315-409 | None |
| A0A6L8KYU4 | 274-371 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.