DPCstruct | MC16398
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 122 ± 23 aa |
| Standard deviation of domain lengths | 22.66 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 87.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 29.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D0IYY0 | 286-431 | LVLPISTAMARHEGHYLRALKSFSAPARDLWTVAKVSDLEYDCAFEGSPEIYHFWDATQCVQFGLEMAKEALQRDLHEEVHFLGRFD… |
| W1KPG3 | 34-147 | GWTSGHEIVVRSDTAPLYRFFDATSVAEYLYDRVIDTVRTDLREELGFLTVFDRAMEGVRAIVDMPDRRAALLIRLLLQNGGRLSNS… |
| A0A1I5HP30 | 146-306 | None |
| A0A7T7Z3D5 | 19-132 | None |
| A0A1L3LDA6 | 3-104 | None |
| T1BAC5 | 34-145 | None |
| A0A2D8EPH5 | 398-516 | None |
| A0A420S0H4 | 666-838 | None |
| A0A1V5RQ42 | 113-224 | None |
| A0A847VFB8 | 1-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.