DPCstruct | MC16391
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 63 ± 6 aa |
| Standard deviation of domain lengths | 6.45 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 48.67 |
| Pfam Score | 90.91 |
| Assigned Pfam label(s) | PF01701- PF00830- CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812RGC8 | 206-272 | KKGRKIAVIECVEQRQMVKDGVPGAGGPRGGVSRYYTEKNVRNTPELLKLRKFNKYLGRHTLHVEIK |
| A0A2G9HWF7 | 1-57 | MVILECTSCILNGVKKVSMGISRYITQKNRHNTPNQLQLRKFYPYCFKHTIHGEIKK |
| G7JH54 | 7-66 | None |
| A0A6A5L6Y6 | 48-101 | None |
| A0A454Y1M2 | 35-94 | None |
| A0A6M8TRB5 | 104-167 | None |
| A0A2A9MPM8 | 64-121 | None |
| A0A866UCN8 | 1-78 | None |
| A0A3G2Z6S9 | 56-114 | None |
| A0A444XJA8 | 35-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.