DPCstruct | MC1639
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 126 ± 14 aa |
| Standard deviation of domain lengths | 14.49 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 63.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.67 |
| Mean length-normalized TM-Score | 0.31 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 40.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J3LZJ0 | 16-130 | KRKERELLAQAPTKALAEPGTDKPAPVPASNKLLAGHLAHEFLTRGTLQGRRVAPEPKPKPSQAAPSSEIPGEPKPETDAAKRMRYT… |
| A0A4D8Y7E9 | 6-139 | ARRILTPGASRKRKETEAPLVPLTSVTRTVSGATASSKGAEAQPVASNRLLAGYMAYEFLTKGTLFGQKFDPGRAEAMPVNVAEPKR… |
| A0A2U1NK10 | 31-185 | None |
| A0A835JPL9 | 1-103 | None |
| A0A835N9E8 | 104-239 | None |
| A0A5N5L4J2 | 4-129 | None |
| A0A2U1KUB9 | 169-301 | None |
| Q9LW53 | 1-108 | None |
| A0A834YTW6 | 1-121 | None |
| A0A7J8X2N2 | 68-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.