DPCstruct | MC16389
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 108 ± 2 aa |
| Standard deviation of domain lengths | 1.68 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 65.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.92 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 35.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E1R5V0 | 1-109 | MSIQPIDLQTLFAHLHSVGKEQAILKDAAVLQQEAQGSELVKETQHRDKSVNEAGEMEDGPGKVEDGKNRNPQSEEEKSKKKKQEEE… |
| A0A7X8CVJ8 | 1-107 | MPIKPIDLQTLFMQMNQVSKEQAAAKDGAVLQQSIQGAVLQKKREDEVRSVQKPQADEGAARIGDRESGSAPGGETESRKRSKDTEE… |
| A0A4R4BMR1 | 1-112 | None |
| A0A660SS96 | 1-108 | None |
| A0A6N7M709 | 1-108 | None |
| A0A3C0SW01 | 1-109 | None |
| A0A6I7QR92 | 1-108 | None |
| A0A3D0Z7Y7 | 1-109 | None |
| A0A8B5WUN5 | 1-105 | None |
| A0A3B9GJY4 | 1-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.