DPCstruct | MC16386
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 191 ± 34 aa |
| Standard deviation of domain lengths | 34.01 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 70.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.65 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 29.32 |
| Pfam Score | 54.17 |
| Assigned Pfam label(s) | PF13422- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A5IGW9 | 14-208 | DEKRDLPVRFEMPYRRFNSQLAVLDDTLFIFSGTFERGDHEFTFNDMYSIDLVKLDGVKELFYNEPEHWNDAMEVESDEEDEEDEEA… |
| A0A7J7SBT3 | 1-137 | MAVKHGRLYLFGGMFEAGERQVTLSDFYCLDLHKMDQWTVLVEADPETQEWLEETDSEDSDAAEGAEGGEEDEEDEDSSEEDQEPQH… |
| A0A7J8XQ51 | 34-201 | None |
| A0A7J6RMM4 | 91-308 | None |
| A0A819CF63 | 141-294 | None |
| A0A815WB55 | 18-174 | None |
| M4C8T9 | 714-943 | None |
| A0A6P5H0W1 | 165-359 | None |
| A0A365MR86 | 696-841 | None |
| R7QFA8 | 404-624 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.