DPCstruct | MC16384
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 62 ± 7 aa |
| Standard deviation of domain lengths | 7.02 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 91.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 43.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W3V452 | 78-123 | CVDIDPVAAMMTYIQLSLLGVPAVVTVGNSLTNVMSQQMVTPMYHL |
| A0A6L6F5A1 | 1-58 | MCTDIDEVAARMCYVQLALLGIPAIVNIGNSLTLDVRQTLYTPMLMLNSFRFKTFLTA |
| A0A437L5I2 | 80-138 | None |
| A0A2T7V0C6 | 2-57 | None |
| A0A2X2V7D1 | 47-101 | None |
| A0A482ZWQ8 | 47-94 | None |
| A0A6S7AHA4 | 48-117 | None |
| A0A2P1BPY2 | 1-67 | None |
| A0A645GGL9 | 53-120 | None |
| A0A077QP51 | 30-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.