DPCstruct | MC16383
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 84 ± 4 aa |
| Standard deviation of domain lengths | 4.25 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 93.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 41.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A849PBL1 | 14-98 | QMRPDGQQETYLVLSELERAKGFVRPVRRTYRHDVCGTVTTMGLPIAETYARNPGFYGGTFCAGCCAHFPVGEQGEFTWLDGTKV |
| A0A2T9KCW5 | 66-157 | ERLPEQYRLIDPVTGEQKGYAVLPAEERAKGFVRPVRRTYTHLTCGKNTSMALAIAETFARAPKIYRTTFCSTCKTHLPVSEFVWLG… |
| A0A3C1F790 | 1-82 | None |
| A0A0F9QGW6 | 89-171 | None |
| A0A7W1MDX0 | 6-86 | None |
| A0A1Q3PSJ8 | 1-73 | None |
| A0A402CQP7 | 24-107 | None |
| A0A4Y9QCR0 | 23-108 | None |
| A0A1Z4G6C8 | 256-341 | None |
| A0A7X7F5X9 | 27-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.