DPCstruct | MC16382
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 132 ± 11 aa |
| Standard deviation of domain lengths | 11.46 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 21.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T9KAM4 | 40-164 | INLSGTLNLQQTTTADCVTSLNANITSATTGNVNSGSFSGGTWVCGILVAPSGFPWSLQPYHDSSTGKDYIKVTGISATSIAGTCSG… |
| A0A5B2UYY2 | 17-154 | DGPFTTNSGTLVVKTPSAPGDITCNVTFGGNVSGGVATITSAQLSGNVLCSLPTLKNIPSPGWVLTANTFDPGTQTGTGTVTGVGWT… |
| A0A6P2UDW0 | 2-128 | None |
| A0A2N5DPX8 | 2-126 | None |
| D3FFG3 | 21-171 | None |
| A0A4V1QVY7 | 8-152 | None |
| A0A7Y9VPJ2 | 29-160 | None |
| A0A1Q4E9I1 | 6-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.