DPCstruct | MC16380
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 81 ± 9 aa |
| Standard deviation of domain lengths | 9.10 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 48.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10041 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A520PPC3 | 1-83 | MCRNIKLLYNFEPPATEDEIYASALQYVRKVSGMRKPSKQNEDCFQRAIDEITEITKRLLLEELETSAPSRDREEEKARAKER |
| F6EM77 | 1-80 | MLRGLEPPATQEEIQAAAVQYVRKVAGISKVSDTTREAFDAAVADVAAATTRLLEQLPARKQPPPTVPPLRRPEVIARLH |
| A0A849ICC4 | 21-123 | None |
| A0A4R1FDU5 | 18-104 | None |
| X8F8T2 | 3-93 | None |
| A0A239B2P1 | 25-101 | None |
| A0A7V9QKW3 | 1-86 | None |
| A0A5C6TN09 | 75-160 | None |
| A0A1R1S9N5 | 112-182 | None |
| A0A1C3YBY4 | 130-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.