DPCstruct | MC1638
Metacluster Properties and Pfam Annotations
| Number of structural domains | 141 |
|---|---|
| Mean domain length (aa) | 191 ± 43 aa |
| Standard deviation of domain lengths | 43.03 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 83.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 42.37 |
| Pfam Score | 99.20 |
| Assigned Pfam label(s) | CL0110- CL0020- CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A268HZY1 | 25-157 | KHLAAKYLLLAAFLGINLVYLIWRTAFTLPTVGILSLIVGILLLVTEWAGFLQSVVFTILSWKPFRRKTIPLSEFKELPTVDVYIAT… |
| A0A4D8Y1G3 | 17-213 | MVINRVHALIHGAALAALFHYRITSITKSLPQLVIFAAELILSFQWLLSQGAKWNPVSRTACPDRLPADDKLPSVDVFVCTTDPVKE… |
| A0A0D3CLC4 | 110-280 | None |
| A0A0E0I264 | 1-167 | None |
| A0A6J5VVN7 | 186-419 | None |
| A0A6V7PM05 | 2-183 | None |
| A0A1U8PRH0 | 2-125 | None |
| A0A5B6VWL8 | 31-201 | None |
| A0A5B6VYT3 | 127-358 | None |
| A0A446LX65 | 29-257 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.