DPCstruct | MC16373
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 101 ± 10 aa |
| Standard deviation of domain lengths | 10.13 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 29.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P2BY49 | 15-114 | HAQDHWLEFAGNANFPDYLRITFVAYGRHAANGHARLDRGDLTRYLIRKDGTLPDRRTIWQAIQKAAQLGYLLPESRQLCLVVSSHQ… |
| A0A372IYK5 | 4-98 | SPLWLRVACLAYGHHLGNGHATFGPGEVRLALSTVDRDGVLRQPASSDVTRAIRTAVGYGWLAEGSGARCLIIPRHAIEGGRGGFST… |
| A0A4Z0N0L4 | 12-107 | None |
| A0A7I7RHA8 | 2-81 | None |
| A0A4U2YJS9 | 2-97 | None |
| A0A1A3TCY9 | 60-166 | None |
| A0A1I3MBI0 | 12-94 | None |
| A0A7K3FUX1 | 18-121 | None |
| A0A081HUR2 | 3-113 | None |
| A0A7W8EG01 | 15-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.