DPCstruct | MC1637
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 183 ± 15 aa |
| Standard deviation of domain lengths | 14.52 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 37.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A166JDS2 | 5-166 | GDNFSAALSAWKAINLLELQKTLDTQGVELVENQKESFVGRKALADRTKDFKKIPEEEKLNAFKGLLKAYQTEIDSLTKRSKFAENA… |
| A0A4D8Y1C8 | 1-181 | MEGLQGGGGGGSEREKPNTSSTSAPVSAVATFWKDFDLEKERTILDEQGLRIAENQENSQKNRRKLAESTRDFKKTSNEEKLALFNS… |
| A0A5A7V499 | 140-329 | None |
| F4RJF1 | 3-194 | None |
| A8PYP3 | 2-186 | None |
| A0A397DI02 | 2-199 | None |
| A0A0M0JMV1 | 2-197 | None |
| A0A1U7LRG5 | 1-186 | None |
| A0A4S4K6L5 | 3-152 | None |
| A0A0C2SRK3 | 8-196 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.