DPCstruct | MC16369
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 196 ± 21 aa |
| Standard deviation of domain lengths | 21.32 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 91.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 23.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V7I4Q7 | 90-273 | RVLTAMAGLASYIFYGYALYSIQGQYTSLYLVYLMLFGASAYGLMFMVPKLIQGSRGTEVPKGLRRGIAGFLLLILVVLAPVWILRM… |
| B9E4C0 | 18-221 | PLLLVSLILNKRSLKGKLLLAGTLGYFLYTYMNYSFLAIYNNFFLIYVLLMSLSLFAFIINITSQKLQNLEKCFSAAMPSKPVGIFI… |
| A0A7C6MZZ1 | 2-173 | None |
| A0A327Z1Q6 | 210-449 | None |
| A0A1M6NMS7 | 1-190 | None |
| A0A521S1M0 | 2-212 | None |
| A0A7W3IZB4 | 80-290 | None |
| A0A0S2M0M0 | 34-216 | None |
| A0A4P9JCU7 | 133-338 | None |
| A0A1Z4NLU2 | 51-248 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.