DPCstruct | MC16368
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 167 ± 17 aa |
| Standard deviation of domain lengths | 16.61 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 92.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 28.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C4PC97 | 18-187 | AVRQVFGQMDDLKRAARGGRVDKRFAEKLMLAVTRVNGCRYCAYGHSRAALAMGVPEEELQRLLAGDLGSFPPEEAVGLAFAQHYAE… |
| A0A7V3DFR2 | 20-154 | ASLLGKPGRLLAILRGKTLSAPFRERLMLAVTQVNQCRYCAHFHTKAALDAGVASDEVRRLLAGEFEGCPAEELTAIVYAHHWAETG… |
| A0A7R9TU86 | 1-186 | None |
| A0A1H2WW62 | 17-192 | None |
| A0A7C2WLZ5 | 40-176 | None |
| A0A7C6TI04 | 49-213 | None |
| A0A7C5EX93 | 82-257 | None |
| A0A843BUJ4 | 4-177 | None |
| A0A847AZA8 | 2-173 | None |
| A0A379A2G4 | 22-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.