DPCstruct | MC16363
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 371 ± 113 aa |
| Standard deviation of domain lengths | 112.52 |
| Length coefficient of variation | 0.30 |
| Mean AlphaFold2 pLDDT confidence score | 86.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 18.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A318ANW6 | 83-319 | LSQAAESGDPYAMDDTPAGRLRKAYAGESESDRIAALRALWANPEDERAEYASHILTARAAARISPSSDYASDAKLLIASMLSAGLD… |
| A0A3B8XNL0 | 130-384 | TPEQLAGLLTSDIPEASPLRRAMIYQSISSAVAADERIRLFKLAFATAEAAGLYYPTVEALYPELDNMEPNEALRPLAAAAARAFIA… |
| A0A354TVL2 | 8-260 | None |
| A0A7V7JL56 | 4-252 | None |
| D0CS79 | 1-442 | None |
| I3THE8 | 15-510 | None |
| A0A2E1QCX8 | 64-493 | None |
| A0A520W8B8 | 72-571 | None |
| A0A2E3S3D3 | 201-452 | None |
| A0A7V5U108 | 1-541 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.