DPCstruct | MC16361
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 140 ± 12 aa |
| Standard deviation of domain lengths | 11.78 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 30.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X7GM95 | 1-137 | MLTPFRLITACAKGHIDEFPYFRWLHKGTVSADGAKHEMKLVSLGRTSSLADLVLECSCGVTPKNLDGTFGPKALAEFGTCSGARPW… |
| A0A075GW21 | 14-159 | KTYPVRFVATCKNGHLDEFPWYRWVHRNKNEMDACSENDAKLYLVDNSKTMSLEGKRVECKNCDAASQEMRTALSKNGLKSAGIFGC… |
| A0A1C4L5M8 | 154-284 | None |
| A0A0E4BS45 | 160-293 | None |
| A0A7C6SLK3 | 2-124 | None |
| A0A2M8VDZ6 | 10-171 | None |
| A0A0E2BM86 | 125-270 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.