DPCstruct | MC1636
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 164 ± 12 aa |
| Standard deviation of domain lengths | 12.10 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 75.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 34.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I1ND32 | 70-223 | QQSDDHGKMKLDQLIDKVQKLWDSSPEPVKKFPHNKALDNFIQLILDLILVVVKYLAVPVFAVTSLSEMSYCAHERKLVFVPLPVLF… |
| A0A4D8XW29 | 1-167 | MEHFNDPSKLVVMLSSTQKKLWNMMPDSVKQFPWKKAETVALEEFLALAKEALKWCLLAYFAFSCLSDISYSISRNKELVIPLGLFV… |
| A0A1P8AVI5 | 9-176 | None |
| A0A7N0SXF1 | 51-212 | None |
| A0A2Z7C9Y6 | 93-261 | None |
| A0A7N0ZXP2 | 53-224 | None |
| A0A0K9NQY8 | 32-207 | None |
| S8EBV7 | 1-155 | None |
| A0A7J7HQ25 | 464-609 | None |
| A0A6V7Q2R9 | 56-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.