DPCstruct | MC16357
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 56 ± 5 aa |
| Standard deviation of domain lengths | 5.26 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.68 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 43.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0737 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L6YDV9 | 1-53 | MSKVIQWKHGTTAQHASFKGRAKEITIDDDLHTIRVHDGSTAGGTVLAKLGEL |
| A0A2D4SIG7 | 1-52 | MAKQVQFRRGTTTEHGSFTGAVGEITFDTTLNTLRAHDGSTAGGTRLARHSE |
| A0A1A6FK21 | 1-64 | None |
| A0A1Z8SQE1 | 1-52 | None |
| A0A7C3CP54 | 1-60 | None |
| A0A2D7XAR2 | 1-61 | None |
| A0A3R7WW30 | 1-69 | None |
| A0A4V2TL21 | 1-51 | None |
| A0A382KFR7 | 1-60 | None |
| J7QNY1 | 1-58 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.