DPCstruct | MC16356
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 105 ± 10 aa |
| Standard deviation of domain lengths | 9.64 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 32.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0193 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M4V9J4 | 228-327 | DDGFTTANSWGYRARAIWDYNSVFAGVNLKPSVAWSHDVKGYSPGPGGNFEEGRKAVSLGLDAEYQNTYTANLSYTNFFDGKYTTVD… |
| A0A2A5EN68 | 21-141 | VCTSGSDLALGGLLAIDARSGCRASTFSYGYVLVGILQYNNAFGTPITLSPSIAWSHDVKGNSPAPLSNYREGRKRVSLSLNGSYQS… |
| A0A7Y2Z166 | 25-131 | None |
| A0A7Y3E552 | 9-117 | None |
| A0A0F2IY10 | 303-418 | None |
| A0A525PQ11 | 1-100 | None |
| A0A418WUU0 | 47-164 | None |
| A0A4U0GEG8 | 295-396 | None |
| A0A418XPD9 | 2-83 | None |
| A0A7W0EWC7 | 6-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.