DPCstruct | MC16355
Metacluster Properties and Pfam Annotations
| Number of structural domains | 63 |
|---|---|
| Mean domain length (aa) | 74 ± 12 aa |
| Standard deviation of domain lengths | 11.65 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 80.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6C0LQE0 | 7-69 | AYTKCTDENGICVIPGPDKKSIAYSTKDGQTQINYRNNNQSISCDNSIFGDPVPKTLKMCSVA |
| A0A2A4S2E5 | 306-381 | GISTSYAPPVALPGTRKWADCGGENQACNFAGTKLVRYGANGHYRYLWARGTTTCSYTNFGGDPAPGVHKRCSVAG |
| A0A1L3SUS3 | 95-157 | None |
| A0A519SXJ7 | 45-110 | None |
| D6V9S7 | 24-108 | None |
| B0UNF6 | 14-92 | None |
| A0A6B8RTT6 | 60-145 | None |
| A0A7V9Q4E1 | 308-383 | None |
| A0A7C2RUQ2 | 27-88 | None |
| A0A5C8LDG8 | 31-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.