DPCstruct | MC16353
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 145 ± 14 aa |
| Standard deviation of domain lengths | 14.41 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 29.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07323 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N1BN94 | 2-116 | SLLVEARNYVAYQEAADQRGLPPTVRLQVSYESMRVTSRLTQVMAWMLAQKAVHAGEITPAQAVGDDYALSGGAVCADPSGPDNLLL… |
| A0A2A4RUP5 | 12-177 | IEEGGVVRTFSSDFATSELFNRSYREGMSLVEETASYLDGPGRSDSKLLPRNSSLAYAAESMRLTTRLMQVAAWLLVQKAVAEGEMS… |
| A0A2D4VLX2 | 36-204 | None |
| A0A350YJZ7 | 5-139 | None |
| A0A0P0YW21 | 1-138 | None |
| Q1NAT3 | 2-141 | None |
| A0A6L3YHL5 | 15-161 | None |
| A0A1W9I4R9 | 14-174 | None |
| A0A219B8E5 | 2-131 | None |
| A0A4Y9ENH6 | 18-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.