DPCstruct | MC16352
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 125 ± 10 aa |
| Standard deviation of domain lengths | 10.18 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 49.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5P1EQA5 | 6-145 | NGENGKVETTGPTTILEGYAMAYFLVLSGAFAWGAGETSPAFASAFSSKRARPISVHLEFMAGVVSGDVLVGCDPATWKAYVMCLLG… |
| A0A427ANN9 | 354-470 | AYFAVLGGMFAWGIDSVSVSKRRPRVIASHMDFLSSVLDGKISLGCNWVLWRAYVSGFLGLVVQCAPYWVLEVDLHILKKLSQGLRR… |
| A0A1D6F4J1 | 529-647 | None |
| A0A7N0REU2 | 4-119 | None |
| A0A0V0IBP8 | 292-405 | None |
| V4LI35 | 695-805 | None |
| A0A438H5H1 | 240-358 | None |
| A0A067FN39 | 880-1015 | None |
| A0A0A9HGW3 | 110-228 | None |
| A0A3B6RB86 | 176-294 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.