DPCstruct | MC16344
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 218 ± 35 aa |
| Standard deviation of domain lengths | 34.85 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 70.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 44.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0133 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D3DQ92 | 2-214 | EAELDSFQRQVAEKFNDLNASSGEILSLSWIGKLLDSFLSCQDEFRAIVFNHRSLIISKPPTDRLLSDYFERTVKALDVCNAIRYGI… |
| A0A5P1E4T7 | 1-195 | MNNHSDGDQESGDLDSFQRHVADLLAAASDSGELLSLSWISKLLGSFLLIQEEFRSVLLRNSSLLRPPLDRSVSDFFERSVKALDVC… |
| A0A4S8J0N5 | 1-276 | None |
| A0A2Z6MFC1 | 2-188 | None |
| A0A444WZA8 | 9-229 | None |
| A0A6N2JXQ3 | 1-261 | None |
| A0A6A6MMZ7 | 1-176 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.