DPCstruct | MC16342
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 86 ± 6 aa |
| Standard deviation of domain lengths | 5.64 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 49.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0110 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6M1D9 | 52-161 | FYGSDERIQACLSEIGIPLTKELGFHQVDIRGNPYGLLAAHPLAPLVSLHHLDYVKSIFPGMNQIDSLQKLNEPYRLDPGRTLQHSV… |
| A0A0D3EFZ1 | 102-185 | QMDLRGDLSGLLSSHPTAPLLSLHHFGALAPLFPGMDRHGSVLQIMKAANVDQSRMLQQSVCYVRARNWTLSVSWGYSAHVYEN |
| A0A835CMD2 | 369-452 | None |
| A0A2I0JI10 | 245-333 | None |
| A9SLD5 | 222-305 | None |
| A0A397XMB3 | 196-279 | None |
| A0A6P3YT41 | 147-230 | None |
| A0A2G3BIM1 | 1-83 | None |
| A0A834TJU4 | 192-274 | None |
| A0A166AAA5 | 185-268 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.