DPCstruct | MC16340
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 58 ± 4 aa |
| Standard deviation of domain lengths | 3.93 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 60.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P6TW36 | 261-317 | TSHPKKVLLTGELVVFGVSAQRPYMKLGVLSADGRKMKHQVDLELKRCTLCHDIGVT |
| A0A0E0LUB5 | 116-173 | TAHPKVDPGSGELIICGFNIVKPFLTVGVVSEDGKKLKQKVDLKLDRCAFCHEIGITK |
| A0A835J584 | 448-514 | None |
| A0A0E0QI75 | 274-330 | None |
| A0A835R7N7 | 1-51 | None |
| A0A2K3NG01 | 27-81 | None |
| A0A061GRK8 | 122-176 | None |
| A0A7J6X0B7 | 668-724 | None |
| A0A5J5A762 | 420-478 | None |
| A0A6A3C6B8 | 47-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.