DPCstruct | MC1634
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 117 ± 12 aa |
| Standard deviation of domain lengths | 11.87 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 75.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 25.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F8ED04 | 22-136 | VIMIGFAVRILGNSLAFYVANLLVPGFVVNGGIKEYLIAGILLGFLNLLVKPLLKLVAMPLIVLSLGLFSFIINGLILWAIDYIFDF… |
| D1C0M2 | 4-135 | MNFVVRVLVTALALWLTSLVIPSHLDVIDDGSKGGTVIAVLLVALVFNLVNLVVKPLVKLLSLPLYILTLGLFTLVVNALMLWLTVW… |
| A0A1V5TVU3 | 4-107 | None |
| A0A536QR23 | 82-210 | None |
| A0A2H0R9I1 | 4-109 | None |
| D3Q5W3 | 1-133 | None |
| A0A354H257 | 2-115 | None |
| A0A1V5RU96 | 2-117 | None |
| A0A7C7E2H5 | 11-135 | None |
| A0A2W4SRC1 | 118-234 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.