DPCstruct | MC16339
Metacluster Properties and Pfam Annotations
| Number of structural domains | 66 |
|---|---|
| Mean domain length (aa) | 173 ± 28 aa |
| Standard deviation of domain lengths | 28.40 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 27.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C7R730 | 25-219 | DNDFFICPASEEDYLAKGRYFINDEKFDRLVEEGQITPKQAREMKKLLSRLKLINHRTTTIYQILYHIKNFQRAYLETGIPKHLVPL… |
| A0A2E2M3I1 | 272-466 | PELRVFHSENRWRIELNSSATSSVELETVASSADCRLAPDISRMLAEANTLRAAVLRRRSTILRVAREAVGRQIAFLERGPSALVRL… |
| T2RDT3 | 3-156 | None |
| A0A2P8ELI0 | 89-236 | None |
| A0A832EJJ4 | 138-293 | None |
| A0A447TUP6 | 27-136 | None |
| A0A1V5FM08 | 324-531 | None |
| A0A1Q7RLK6 | 113-287 | None |
| W3YJL2 | 4-168 | None |
| W4PHV4 | 51-273 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.