DPCstruct | MC16336
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 122 ± 17 aa |
| Standard deviation of domain lengths | 16.50 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 89.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 44.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W9WUQ9 | 185-311 | ADDMPMGDPQGYATTEELTIGAIISTEEKGPVDAVWEQGGQDVTQRGDQVIWGHFYAHPSDVTWGQQDNPDLFVKIWFDVSGRIDAN… |
| A0A1W9MWI8 | 39-151 | VYMSASIDTVEKGEVLMYREVMTDEKTSGGDRVITGYFYVPTTSGISWASISNPELLFKVWIDRSGRVDINYVHVSVPRITTYSWDN… |
| A0A1W9N463 | 392-501 | None |
| A0A2N9YAP9 | 57-179 | None |
| A0A1W9XAW7 | 263-396 | None |
| A0A1W9X546 | 765-875 | None |
| A0A661SNZ6 | 106-262 | None |
| A7BKX6 | 2-105 | None |
| A0A1W9MJ95 | 510-606 | None |
| A0A496VTL1 | 784-906 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.