DPCstruct | MC16335
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 185 ± 19 aa |
| Standard deviation of domain lengths | 18.67 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 25.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6C2UAX4 | 8-195 | PATSVLKCLGMVLAGSALYGVAFGIWRSPLQACYSAIKMPLLFLSIVATSGTANAMLSQALGAGLSFRQVFRCIAIGMAIAAALLGA… |
| A0A1W9MVI4 | 104-301 | KIYNQEELDAQIRYFSLYALMFSAGYGLFLGMFSGNLQIIASLIKVPILMFGTLLICLPVLYLLNTLIGYKLTLKQTLTLLVASAYM… |
| A0A7C3S7D0 | 2-160 | None |
| A0A359MUQ3 | 146-345 | None |
| A0A2V6GB70 | 249-443 | None |
| A0A661NTL0 | 26-209 | None |
| A0A3D1QZA3 | 36-218 | None |
| T2K016 | 8-169 | None |
| A0A3D0N2A9 | 37-233 | None |
| A0A7C3W7B2 | 2-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.