DPCstruct | MC16334
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 73 ± 6 aa |
| Standard deviation of domain lengths | 6.47 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 93.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 35.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N2GIP5 | 3-73 | ASGTNLYASYTGSGIYMHNGTAWSQITPGNPEKMLTSNNILYADFGANGLYQYNGTIWSQLTTGNPADMVV |
| A0A1W9MTP9 | 11-81 | TSEDMIAADFGDKGLYLYDGSSWKGVTGWNPENIVVYGDILTADFGDKGLYLYDGSAWTGIVGWNPEEVVT |
| A0A094JYU1 | 949-1022 | None |
| A0A1W9N0I2 | 5-65 | None |
| A0A7C7RJ01 | 2-64 | None |
| A0A1F5AH35 | 1-84 | None |
| A0A3N5RRF0 | 739-819 | None |
| A0A1U7CV06 | 541-617 | None |
| A0A1W9MTQ6 | 101-174 | None |
| A0A1W9LKY2 | 109-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.