DPCstruct | MC16329
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 62 ± 7 aa |
| Standard deviation of domain lengths | 7.35 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 42.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W9LQ39 | 57-113 | LCLNNQDYEISLERWKIYETLRDDEALCRRLIQVIDESGEDYLYPAELFFKIELPTN |
| A0A2H0AKW4 | 4-71 | SFAICIKNSKYPASLELHKVYRVLPDKDAETDGDLRIIDESGEDYLYPADYFVMTEVTEEAAPILMGS |
| Q1PZ97 | 2-58 | None |
| A0A7W1DDU5 | 3-77 | None |
| A0A1E7YN23 | 2-60 | None |
| A0A6L7WNY4 | 5-57 | None |
| W4LN89 | 74-133 | None |
| A0A433VLU3 | 7-63 | None |
| A0A7W1ZJM1 | 19-91 | None |
| A0A3B9MPF2 | 4-60 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.