DPCstruct | MC16327
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 185 ± 24 aa |
| Standard deviation of domain lengths | 24.49 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 18.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C4ZVN4 | 8-180 | DFVLAQRDKIGKTIEDFVILEVMAVSTTGTGQIIRSMLDVLNNTNNASKKYGINFRQVISRLIVQGLVKAEACEAWQKSMIWAVQDV… |
| A0A6L7T7C6 | 83-275 | LEDIAVHYFGNTDNTVVFSEVRLPNVGNIDYVIIKHKPMQATVDEFVAVEFQSDSTTQTGELVRGIDDFYAGRDIQKRFYRFGMNTY… |
| A0A6L3EXK8 | 24-190 | None |
| A0A419KBD5 | 30-204 | None |
| A0A7X7M1R9 | 54-235 | None |
| A0A369QCI6 | 4-161 | None |
| A0A0K0GID4 | 33-224 | None |
| A0A844MB51 | 190-359 | None |
| A0A1V4M7S9 | 184-373 | None |
| Q3APT7 | 296-495 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.