DPCstruct | MC16326
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 115 ± 9 aa |
| Standard deviation of domain lengths | 8.98 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 46.72 |
| Pfam Score | 95.00 |
| Assigned Pfam label(s) | PF17708- CL0293 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7XHL2 | 59-172 | LLLYLLEALMVLSDIQHDLLAQSMERRILLPQRDLVRSILERNFYRFQNIPFTLQPELLAQLQEEGLVITYELLDECGLEMEPNSPR… |
| A0A836A6Y8 | 192-323 | FLSGAGSLPIPQALLSPDPLWTLIRAAQVLSDIQHELLAWSMEKKILPQQRELVKSILEPNFRNLWNIPFTLDPKLLALLQEEGLVV… |
| A0A811ZZM7 | 347-468 | None |
| A0A2J8X2I2 | 1-122 | None |
| A0A2Y9DEF5 | 344-449 | None |
| A0A6P6BKB3 | 362-472 | None |
| S7PBC3 | 80-190 | None |
| A0A485N8E4 | 463-576 | None |
| F1PF87 | 935-1056 | None |
| A0A2Y9EHS8 | 2-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.