DPCstruct | MC16324
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 94 ± 6 aa |
| Standard deviation of domain lengths | 6.20 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 62.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9DGC9 | 9-97 | HLGLCAFRHSNIKDAHNCLVDLMMTGKVKELLAQGLLPQRQHERSKEQEKIEKQRQMPFHMHINLELLECVYLVSAMLIEIPYMAGF… |
| A0A6J0J8I0 | 61-159 | LYNRTMVQLGICAFRQGLIKDAHNALLDIQSSGRAKELLGQGLLLRSLQERNAEQEKVEKRRQVPFHMHVNLELLECVYLVAAMLLE… |
| A0A3S5CKY8 | 67-152 | None |
| A0A2I0LH65 | 7-105 | None |
| A0A835LPX3 | 286-384 | None |
| A0A553P924 | 620-718 | None |
| E2LUV5 | 513-597 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.