DPCstruct | MC16318
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 81 ± 7 aa |
| Standard deviation of domain lengths | 6.77 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 31.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0179 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U9CVB3 | 63-140 | LLIPTVKTWWCGRAEDRDFVIRNLEHLIIKPSWRSFDSKSIYGHSLDERNRMLTIEQITANPHNYVAQVYIPGSRVPV |
| A0A7V6VJM9 | 280-343 | LPSVTTYWCGDRVMCSHVIAHVSRLVLRSVASHEIHDGRTKSIRELADLCALIADEPWDWVGQE |
| A0A849EXK2 | 24-109 | None |
| E2CP29 | 15-90 | None |
| A0A0P7YIW4 | 170-247 | None |
| A0A6N9BYN3 | 392-466 | None |
| A0A6G3VE85 | 1-84 | None |
| A0A846FCC0 | 67-142 | None |
| A0A534XXC7 | 663-750 | None |
| A0A378UUE7 | 90-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.