DPCstruct | MC16316
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 159 ± 14 aa |
| Standard deviation of domain lengths | 13.72 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 31.04 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | PF20501- PF13244 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X9DZY8 | 84-229 | LEGTIKFAKNSTKALQSGYLRYYIIWIIATTVLIAGYTLFNFRNDIKLSISFNPTLLEIIITLIMIASTYIAIRAKSRLVSIIGVGV… |
| A0A1U1FEU1 | 2-144 | LRGADVLSQRLTALTQRGSIPFTQATILVTLVMLPTIVLAVGDRDQAHLKLWDSPLQGVVGLLILAAAIGATVMRNRLAAVLLVGIT… |
| A0A162FZV8 | 1-164 | None |
| A0A7X8RDD0 | 150-321 | None |
| A0A7C3DY83 | 2-135 | None |
| A0A090SHN5 | 2-163 | None |
| A0A7V7BE46 | 210-384 | None |
| A0A4Y3V6U1 | 790-968 | None |
| A0A345UHF0 | 548-696 | None |
| I3UC50 | 38-209 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.