DPCstruct | MC1631
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 190 ± 7 aa |
| Standard deviation of domain lengths | 7.09 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 92.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 37.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A350UG56 | 65-252 | LRNLPKYRNVDWGDRGSVNGYTDTIESAIYLLAREPVDEAFTWVESEIRIMEMSQQPGGLVENWYGDGNFSRTLQLYALMHSHGVRP… |
| A0A849ZRJ3 | 1-192 | RARDAAIGHRAAAWRGGMDGYADSIEGMLYLLPWIGTGQAEQWVDEQTGILLAHQQPDGFVGRTYLDGNYVRTALLYSLFRTGGARL… |
| A0A1G2Z1R2 | 918-1114 | None |
| A0A7C4S2D4 | 1001-1182 | None |
| A0A2W4RK05 | 1-183 | None |
| A0A7X7FQM6 | 375-573 | None |
| A0A7Y4QPY5 | 632-831 | None |
| A0A7X7IR97 | 163-342 | None |
| A0A0G3EH20 | 492-687 | None |
| A0A847GF45 | 152-337 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.