DPCstruct | MC16305
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 156 ± 20 aa |
| Standard deviation of domain lengths | 19.70 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 42.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K9YPQ1 | 11-144 | SADDYCILGLATCFVREDGEIQEVEVIEPIPSAYWETMLRGVETSYKFVCAKTVGDILVNDSLQKPDEFPPQSQFCHNFTEMMLAAT… |
| A0A0D2MK59 | 3-162 | VGLDSYCCLGLAHCFRKKEDGKLEDVFVIEPLSATSLECMATGARTSFKVAVGVKVADALSRNKGALPEAFQDGLWCEKYDARLDAA… |
| A0A2P6TBW7 | 58-222 | None |
| A0A836BVS6 | 2-137 | None |
| A0A7S1DED9 | 43-229 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.