DPCstruct | MC16303
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 155 ± 28 aa |
| Standard deviation of domain lengths | 28.48 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 78.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 34.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0128 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C3KN79 | 1-168 | MTRTRWTVDGPDDAAVLEIEGRRFSTNNEGVPTMCNLVCRTMGGHAHIDYCRSDEEAACMGNDEVQHIMKRLRPNPDRPKDYVTHNL… |
| A0E3A9 | 208-367 | GLHYSSKHRNKDDQKFTQQQGKNSQIKVLSEDGKLVKNYVVGDVSSPETCRESCKRRGRSHFHLIECKGGDSCLEKTLQRYARHSKE… |
| A0A397VD73 | 1-157 | None |
| A0A067CRK7 | 893-1035 | None |
| W2PG38 | 821-967 | None |
| A0A1B7MR54 | 199-343 | None |
| D0N9V3 | 62-251 | None |
| A0A3F2RSC6 | 1-157 | None |
| A0A7J7QQ68 | 2-164 | None |
| A0A820XUY7 | 15-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.